DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and Arl14ep

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_038960858.1 Gene:Arl14ep / 311279 RGDID:1311463 Length:307 Species:Rattus norvegicus


Alignment Length:139 Identity:42/139 - (30%)
Similarity:72/139 - (51%) Gaps:39/139 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDSDYSISRNLRQRHRKKGVSN----------EYSN------YLDSENKKKGRKKCQNSA----- 48
            :|||        .|.|:|..|:          :::|      :.....|::.||..:|::     
  Rat   128 VDSD--------DRQRRKPESDGRTAKALRSLQFTNPGKQTEFAPESGKREKRKLTKNASASSDR 184

  Fly    49 ---------YDEYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQCRSNRKFFYEDITYDG 104
                     ||..|.:..:|:|:|||::::|.||:|.|.:||||:||.:||.:||:.||.|..:|
  Rat   185 QIIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPTCGSTKCGAECRCDRKWLYEQIEIEG 249

  Fly   105 KDLNIQNKY 113
            .:: |.||:
  Rat   250 GEI-IHNKH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 35/116 (30%)
Arl14epXP_038960858.1 ARF7EP_C 145..248 CDD:405617 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8919
eggNOG 1 0.900 - - E1_KOG4850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056242at2759
OrthoFinder 1 1.000 - - FOG0004362
OrthoInspector 1 1.000 - - otm45548
orthoMCL 1 0.900 - - OOG6_107772
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3647
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.