DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and Arl14ep

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001020273.1 Gene:Arl14ep / 212772 MGIID:1926020 Length:276 Species:Mus musculus


Alignment Length:128 Identity:42/128 - (32%)
Similarity:70/128 - (54%) Gaps:23/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KPYLDSDYSISRNLRQ-RHRKKGVSNEYSNYLDSENKKKGRKK---------------CQNSAYD 50
            ||  |||...::.||. :....|...|::    .|..|:.::|               .::..||
Mouse   137 KP--DSDGRTAKALRSLQFTNPGKQTEFA----PEGGKREKRKLTKATSAASDRQIIPAKSKVYD 195

  Fly    51 EYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQCRSNRKFFYEDITYDGKDLNIQNKY 113
            ..|.:..:|:|:|||::::|.||:|.|.:||||:||.:||.:||:.||.|..:|.:: |.||:
Mouse   196 SQGLLIFSGMDLCDCLDEDCLGCFYACPTCGSTKCGAECRCDRKWLYEQIEIEGGEI-IHNKH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 32/102 (31%)
Arl14epNP_001020273.1 ARF7EP_C 145..248 CDD:317373 33/106 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..177 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9134
eggNOG 1 0.900 - - E1_KOG4850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004362
OrthoInspector 1 1.000 - - otm43485
orthoMCL 1 0.900 - - OOG6_107772
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3336
SonicParanoid 1 1.000 - - X3647
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.