DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and arl14epl

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_031750974.1 Gene:arl14epl / 100495946 XenbaseID:XB-GENE-6035241 Length:168 Species:Xenopus tropicalis


Alignment Length:98 Identity:36/98 - (36%)
Similarity:57/98 - (58%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDYSISRNLRQRHRKKGVSNEYSNYLDSENKKKGRKKCQNSAYDEYGNIRSNGLDICDCMNQECD 71
            :|::....:|   :||...::.:.|. |.||...:|      ||:.|.:..|.:|:|||:.:.|.
 Frog    68 ADFNPENRMR---KKKECMSQLNGYY-STNKVSVKK------YDKQGKLLCNNIDLCDCLEESCQ 122

  Fly    72 GCWYNCRSCGSTRCGPQCRSNRKFFYEDITYDG 104
            ||:|.|..|.||:|||:||.|||:.|:.|..:|
 Frog   123 GCFYPCPKCSSTKCGPECRCNRKWVYDRIQVEG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 34/86 (40%)
arl14eplXP_031750974.1 ARF7EP_C 52..154 CDD:405617 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.