DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and arl14ep

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_031755647.1 Gene:arl14ep / 100127699 XenbaseID:XB-GENE-5726293 Length:218 Species:Xenopus tropicalis


Alignment Length:107 Identity:37/107 - (34%)
Similarity:61/107 - (57%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GVSNEYSNYLDSENKKKGRKKCQ---------------NSAYDEYGNIRSNGLDICDCMNQECDG 72
            |...|::    .|..|:.:::.|               |..||..|.:..||:|:|||::::|.|
 Frog   116 GKQTEFA----PETSKREKRRLQTKSAASNSGQTAASKNKVYDSNGILICNGMDLCDCLDEDCLG 176

  Fly    73 CWYNCRSCGSTRCGPQCRSNRKFFYEDITYDGKDLNIQNKYI 114
            |:|:|:.|||.:||.:||.:||:.||.|..:|.| .|:||::
 Frog   177 CFYSCKKCGSNKCGVECRCDRKWLYEQIEVEGGD-TIRNKHV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 32/94 (34%)
arl14epXP_031755647.1 Suf <1..101 CDD:399092
ARF7EP_C 104..207 CDD:405617 32/94 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8707
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056242at2759
OrthoFinder 1 1.000 - - FOG0004362
OrthoInspector 1 1.000 - - otm48645
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3336
SonicParanoid 1 1.000 - - X3647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.