DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and GPA2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_010937.3 Gene:GPA2 / 856741 SGDID:S000000822 Length:449 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:125/343 - (36%)
Similarity:189/343 - (55%) Gaps:44/343 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWG 195
            :::|:||||||||||||.|:|::|:|...|..:.:.||..:||||::...:.|:.||.:.|:   
Yeast   122 KELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNV--- 183

  Fly   196 SDGREQDAYDAKLMECNSLDVPKFMEYAPP--------------ISRLW-----QD--RGIRRAF 239
              ..|.:.      |....|:.:.|.|..|              ||.||     ||  .|     
Yeast   184 --NLEPEC------ELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNG----- 235

  Fly   240 ERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKV-QNIPFVFVDVGGQ 303
            ....:|.:.||..||::...|:.:|:|.||.:|||..|:.|.|:::..:.: .:|.....|||||
Yeast   236 PNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQ 300

  Fly   304 RTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFL 368
            |::|:||..||| :||.:||.||.||:||.|.||:..||.:||..:||.|||:..|...|::|||
Yeast   301 RSERKKWIHCFD-NVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFL 364

  Fly   369 NKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTR 433
            ||.||..:|:  .:..:..|:|.:.|. ..:.....:||..|:.:.|::  ..||.|.|.|.||.
Yeast   365 NKIDLFAEKL--SKVPMENYFPDYTGG-SDINKAAKYILWRFVQLNRAN--LSIYPHVTQATDTS 424

  Fly   434 NINVVFNSVKDTILQRNL 451
            ||.:||.::|:|||:..|
Yeast   425 NIRLVFAAIKETILENTL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 125/343 (36%)
G-alpha 133..451 CDD:206639 124/339 (37%)
GPA2NP_010937.3 G-alpha 124..442 CDD:206639 124/339 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.