DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and GPA1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_011868.1 Gene:GPA1 / 856394 SGDID:S000001047 Length:472 Species:Saccharomyces cerevisiae


Alignment Length:457 Identity:136/457 - (29%)
Similarity:218/457 - (47%) Gaps:116/457 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIY 173
            |:.:..:..|::.|:.||...:.::||||||||||||||.|||::::|...|.::..|:|..||:
Yeast    18 LQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIW 82

  Fly   174 QNVIRGMQVL----------LDAREKLN-----------------------IAWGSD-------- 197
            .:.|:.|::|          ||..:.:|                       :|.|||        
Yeast    83 ADAIQSMKILIIQARKLGIQLDCDDPINNKDLFACKRILLKAKALDYINASVAGGSDFLNDYVLK 147

  Fly   198 --------------GREQDAYD--------------------------------AKLME-CNSL- 214
                          ||.:.|:|                                ..|.: |..| 
Yeast   148 YSERYETRRRVQSTGRAKAAFDEDGNISNVKSDTDRDAETVTQNEDADRNNSSRINLQDICKDLN 212

  Fly   215 ---DVPKFM------------------EYAPPISRLW-QDRGIRRAFERRREFQISDSVSYFLDE 257
               |...|:                  :.|..|.:|| .|:||::.|.|..|||:..|.:|:.|.
Yeast   213 QEGDDQMFVRKTSREIQGQNRRNLIHEDIAKAIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDN 277

  Fly   258 IQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSII 322
            |::.|:|:||.|.:|||..|..|.|:.|....:.:..|..:|.||||::|:||..||: .:|:::
Yeast   278 IEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFE-GITAVL 341

  Fly   323 FLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRW 387
            |:::.||:||:|.||.:.||:.||..:|||::|:..||....||||||.||.|:||  ....||.
Yeast   342 FVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKV--KSMPIRK 404

  Fly   388 YYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLN 452
            |:|.:.|..........:..::|:|:.:::  ..||...|.|.||:.:..|.::|.|.|:|:||.
Yeast   405 YFPDYQGRVGDAEAGLKYFEKIFLSLNKTN--KPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLK 467

  Fly   453 AL 454
            .:
Yeast   468 KI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 135/454 (30%)
G-alpha 133..451 CDD:206639 129/428 (30%)
GPA1NP_011868.1 G-alpha 42..466 CDD:206639 129/428 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.