DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and XLG2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:370 Identity:83/370 - (22%)
Similarity:146/370 - (39%) Gaps:87/370 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSD- 197
            ||||:|:.:.|.:|..||.|.::.|:|..|.....:.:|..|:...:.::|:|.|:......:| 
plant   464 KLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQ 528

  Fly   198 --GREQDAYDAKLMECNSLDVPKFMEYA---------------PPISR--------LWQDRGIRR 237
              |...|...||  ..||:: |:...::               ||.||        ||:...|:.
plant   529 SSGNVGDETSAK--PGNSIN-PRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQA 590

  Fly   238 AFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGG 302
            .::|.|:....::| |||:.|..::..:|.|:..|||.....:......||     .|.|.....
plant   591 TYKRLRDTLPRNAV-YFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCV-----DFSFPSTSQ 649

  Fly   303 Q----------------------RTQRQKW--TRCFDSSVTSIIFLVSSSEFDQVL--AEDRKTN 341
            :                      |:..:.|  ...|:.: ..:||.||.:::.:.:  .|....|
plant   650 EESLESDYQHDTDMKYQLIRLNPRSLGENWKLLEMFEDA-DLVIFCVSLTDYAENIEDGEGNIVN 713

  Fly   342 RLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIR---WYYPHFNGNPHSVLDVQ 403
            ::..:|.:|:.:|.:.:......:|.|.|.||||:|:  .|..:|   |:.           |..
plant   714 KMLATKQLFENMVTHPSLANKRFLLVLTKFDLLEEKI--EEVPLRTCEWFE-----------DFN 765

  Fly   404 NFILQMFMSVRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQ 448
            ..|.|...|........|.:|:         |...|..:.|:||:
plant   766 PLISQNQTSRHNPPMAQRAFHY---------IGYKFKRLYDSILE 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 83/370 (22%)
G-alpha 133..451 CDD:206639 83/370 (22%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 83/370 (22%)
G-alpha 464..837 CDD:278904 83/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.