DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gna11

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_112295.1 Gene:Gna11 / 81662 RGDID:619749 Length:359 Species:Rattus norvegicus


Alignment Length:365 Identity:160/365 - (43%)
Similarity:223/365 - (61%) Gaps:24/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155
            ||           .:.|..|.:..:.||:|.|.::|...||::||||||.||||||||:||||||
  Rat     9 CC-----------LSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRII 62

  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM 220
            ||..:..|....:..::|||:...||.::.|.:.|.|.:   ..||:..:|.|:  ..:||.|..
  Rat    63 HGAGYSEEDKRGFTKLVYQNIFTAMQAVVRAMDTLKIRY---KYEQNKANALLI--REVDVEKVT 122

  Fly   221 ----EYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATK 281
                :|...|..||.|.|::..::||||||:|||..|:|.::.|:||..|:||.:|:|..|..|.
  Rat   123 TFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTT 187

  Fly   282 GVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEES 346
            |:.|:...::||.|..|||||||::|:||..||: :||||:|||:.||:||||.|....||:|||
  Rat   188 GIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFE-NVTSIMFLVALSEYDQVLVESDNENRMEES 251

  Fly   347 KNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFM 411
            |.:|.||:....|:..|:||||||.||||.|:.:  :.:..|:|.|:|........:.|||:||:
  Rat   252 KALFRTIITYPWFQHSSVILFLNKKDLLEDKILH--SHLVDYFPEFDGPQRDAQAAREFILKMFV 314

  Fly   412 SVRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNL 451
            .:...|. ..||.|||.|.||.||..||.:|||||||.||
  Rat   315 DLNPDSD-KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 156/344 (45%)
G-alpha 133..451 CDD:206639 147/321 (46%)
Gna11NP_112295.1 G_alpha 19..357 CDD:214595 156/344 (45%)
G-alpha 40..353 CDD:206639 147/321 (46%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.