DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and LOC797518

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_021331576.1 Gene:LOC797518 / 797518 -ID:- Length:341 Species:Danio rerio


Alignment Length:357 Identity:123/357 - (34%)
Similarity:197/357 - (55%) Gaps:45/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :::.||.:|::|.   |..:.:||:|..:||.|||.||:|:|:|.:|:.:..|.::..||:|:|:
Zfish     3 RTRTIDAWLKREA---RMPLLILLVGMNDSGTSTFFKQIRLINGEDFNLKQRLGFREAIYENIIQ 64

  Fly   179 GMQVLLDAREKLNIAWGSDGRE--------QDAYDAKLMECNSLDVPKFMEYAPPISRLWQDRGI 235
            ||.||:..|.||.|...:...|        .|....|..|.::     |..|...:..||:|.||
Zfish    65 GMWVLVKERNKLGIPLQNSANEIHEISFTSDDCLRVKFTEPSA-----FQPYVEAVDSLWKDSGI 124

  Fly   236 RRAFERR----REFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFV 296
            :..:.|.    .|:.|.|||.|..|.|||:...||:|.::||||.|.....:.:....:::.|||
Zfish   125 QETYRRSDFKGHEYFICDSVKYHFDNIQRIGQLDYLPHNQDILHARSRWTTLEDMYYVLRDTPFV 189

  Fly   297 --------FVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTI 353
                    |:       .|.|    |:...|:|:|::.||::|::|.:   :|.|.:|.:||.:|
Zfish   190 VAQSSILPFI-------ARMK----FNFRDTTILFIIGSSDYDRMLYD---SNCLADSLSIFKSI 240

  Fly   354 VNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSS 418
            :|:..:...:|||..||.|||.:||  ...|||.::|.|.|:||.:.|||.|::|.| .:|:..:
Zfish   241 INHKYYSSSTIILLFNKMDLLREKV--QTADIRKHFPEFQGDPHRLEDVQKFLVQSF-KMRKLKN 302

  Fly   419 ISRIYHHFTTAIDTRNINVVFNSVKDTILQRN 450
            ...||:|..||:||.||..|:|::|..||.:|
Zfish   303 SGPIYYHMITAVDTENIRTVYNTIKHAILSKN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 123/357 (34%)
G-alpha 133..451 CDD:206639 118/338 (35%)
LOC797518XP_021331576.1 G-alpha 21..334 CDD:206639 117/334 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586208
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D299429at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.