DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnaq

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001037982.1 Gene:gnaq / 733773 XenbaseID:XB-GENE-973433 Length:359 Species:Xenopus tropicalis


Alignment Length:365 Identity:154/365 - (42%)
Similarity:222/365 - (60%) Gaps:24/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155
            ||           .:.|..|.|..:.||::.|.::|...||::||||||.||||||||:||||||
 Frog     9 CC-----------LSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRII 62

  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM 220
            ||..:..|....:..::|||:...||.::.|.:.|.|.:..:..:..|     :....:||.|..
 Frog    63 HGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKGHA-----LLIREVDVEKVA 122

  Fly   221 EYAPP----ISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATK 281
            .:..|    |..||.|.||:.|::||||:|:|||..|:|:::.|:|:..|:|:.:|:|..|..|.
 Frog   123 SFENPYVDAIKYLWNDPGIQEAYDRRREYQLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTT 187

  Fly   282 GVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEES 346
            |:.|:...:|::.|..|||||||::|:||..||: :||||:|||:.||:||||.|....||:|||
 Frog   188 GIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFE-NVTSIMFLVALSEYDQVLVESDNENRMEES 251

  Fly   347 KNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFM 411
            |.:|.||:....|:..|:||||||.||||:|:.  .:.:..|:|.::|........:.|||:||:
 Frog   252 KALFRTIITYPWFQNSSVILFLNKKDLLEEKIM--YSHLVDYFPEYDGPQRDAQAAREFILKMFV 314

  Fly   412 SVRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNL 451
            .:...|. ..||.|||.|.||.||..||.:|||||||.||
 Frog   315 DLNPDSD-KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 150/344 (44%)
G-alpha 133..451 CDD:206639 141/321 (44%)
gnaqNP_001037982.1 G-alpha 40..353 CDD:206639 141/321 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.