DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnai3

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001011471.1 Gene:gnai3 / 496962 XenbaseID:XB-GENE-5738634 Length:354 Species:Xenopus tropicalis


Alignment Length:338 Identity:138/338 - (40%)
Similarity:209/338 - (61%) Gaps:4/338 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....::|||||||||||||||.:|||:|||...:..|...:|:.|:|.|.|:
 Frog    15 RSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYKVVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFMEYAPPISRLWQDRGIRRAFERRR 243
            .:..::.|..:|.|.:|...|..||....::..::.:.....|.|..|.|||:|.|::..|.|.|
 Frog    80 SIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMSPELAGVIQRLWEDPGVQACFSRSR 144

  Fly   244 EFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQ 308
            |:|::||.||:|::|:|:|..:|:||.:|:|..|..|.|:.|.....:::.|...||||||::|:
 Frog   145 EYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERK 209

  Fly   309 KWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDL 373
            ||..||: .||:|||.|:.|::|.:||||.:.||:.||..:||:|.||..|...||||||||.||
 Frog   210 KWIHCFE-GVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIILFLNKKDL 273

  Fly   374 LEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNINVV 438
            .|:|:......|  .||.::|: ::..:...:|...|..:.|......||.|||.|.||:|:..|
 Frog   274 FEEKISRSPLTI--CYPEYSGS-NTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFV 335

  Fly   439 FNSVKDTILQRNL 451
            |::|.|.|::.||
 Frog   336 FDAVTDVIIKSNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 138/338 (41%)
G-alpha 133..451 CDD:206639 131/317 (41%)
gnai3NP_001011471.1 G-alpha 34..348 CDD:206639 131/317 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.