DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gna14

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001008054.1 Gene:gna14 / 493416 XenbaseID:XB-GENE-945095 Length:354 Species:Xenopus tropicalis


Alignment Length:369 Identity:157/369 - (42%)
Similarity:227/369 - (61%) Gaps:22/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155
            ||           .|.||.|.:..:.||:|.|.::|...||::||||||.||||||||:||||||
 Frog     4 CC-----------LTAEEKESQRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRII 57

  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLME---CNSLDVP 217
            ||..:..|....:..::|||:...||.::.|.:.|.|.:.|:...::|...:.:|   .:||:  
 Frog    58 HGSGYTDEDRKGFTKLVYQNIFTSMQAMIRAMDTLRIQYSSEQNMENALTVREVEVDKVSSLE-- 120

  Fly   218 KFMEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKG 282
              .::...|.:||:|.||:..::||||:|:|||..|:|.:|.|::.|.::||.:|:|..|..|.|
 Frog   121 --RKHVEAIKKLWEDEGIQECYDRRREYQLSDSTKYYLSDIDRISNPSFIPTQQDVLRVRVPTTG 183

  Fly   283 VYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESK 347
            :.|:...::||.|..|||||||::|:||..||: :||||||||:.||:||||||....||:||||
 Frog   184 IIEYPFDLENIIFRMVDVGGQRSERRKWIHCFE-NVTSIIFLVALSEYDQVLAECDNENRMEESK 247

  Fly   348 NIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMS 412
            .:|.||:....|:..|:||||||.|||::|:.  .:.:..|:|.|.|........::|||:::..
 Frog   248 ALFRTIITYPWFQNSSVILFLNKKDLLQEKIM--YSHLIDYFPEFTGPKQDSQSARDFILKLYQD 310

  Fly   413 VRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLNALML 456
             :.......||.|||.|.||.||..||.:|||||||.||....|
 Frog   311 -QNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 150/345 (43%)
G-alpha 133..451 CDD:206639 141/320 (44%)
gna14NP_001008054.1 G-alpha 35..348 CDD:206639 141/320 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.