DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gna15.1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001003626.2 Gene:gna15.1 / 445232 ZFINID:ZDB-GENE-040801-146 Length:367 Species:Danio rerio


Alignment Length:373 Identity:150/373 - (40%)
Similarity:220/373 - (58%) Gaps:23/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CFRCCGNIITYLVRLRSTPEELEQRYK-SKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQ 151
            |:|.|     |...:....||.:.... ..||.:.|.::|...||::|:||||.|||||:||:||
Zfish     3 CWRWC-----YTTCICCLSEEDKNAIVIHNEIKRILAEQKKRERREIKVLLLGTGESGKTTFIKQ 62

  Fly   152 MRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAY-----DAKLMEC 211
            ||||||..|..|....|...:|||:...|:.:..|.|.|.|.:.:.  :.:||     |.::.:.
Zfish    63 MRIIHGKGFSEEDRRGYIKNVYQNIFTAMRAMTGAMESLRIPYANP--QNEAYGRQFKDVEIRQV 125

  Fly   212 NSLDVPKFMEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHC 276
            ..||    ..|...|.|||.|.||:..:.||||:|:.||..|::..:.|:|.|||:||.:|:|..
Zfish   126 TQLD----RMYVEAIRRLWADPGIKACYCRRREYQLLDSTEYYMTNLDRIAAPDYIPTAQDVLRV 186

  Fly   277 RKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTN 341
            |..|.|:.::...|:.|....||||||:::|:||..||: :|||:|||.|.||:||||.|:.|.|
Zfish   187 RFPTTGINDYSFSVEKITLRIVDVGGQKSERRKWIHCFE-NVTSLIFLASLSEYDQVLEENSKEN 250

  Fly   342 RLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFI 406
            |::||.::|.|.:::..|...||||||||.|:||:|:  ..:|::.|:|.|.|....|.|.:::|
Zfish   251 RMKESLSLFYTTIHSPWFASASIILFLNKMDILEEKI--QSSDLKAYFPEFQGRRRDVQDAKSYI 313

  Fly   407 LQMF---MSVRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNL 451
            ..::   .....:.:..:||.|||.|.||.||..||..||||:|.|:|
Zfish   314 SHLYEQKAKCTETKTSKQIYPHFTCATDTNNIRKVFGDVKDTVLIRSL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 144/349 (41%)
G-alpha 133..451 CDD:206639 137/325 (42%)
gna15.1NP_001003626.2 G-alpha 44..361 CDD:206639 137/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.