DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Galphaf

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster


Alignment Length:358 Identity:127/358 - (35%)
Similarity:183/358 - (51%) Gaps:41/358 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSD 197
            ||:||||..||||:|.:|||||:|...|..:...|....||||:...:..|:.....|.|.:||.
  Fly    48 VKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSC 112

  Fly   198 GREQDA-YDAKLMECNSLDVPKFM--EYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQ 259
            ..|:.| |...|..    ..|::|  ||...::.||.|.|||..::|..||.:.||..||||...
  Fly   113 TSERSADYILSLPG----SAPEYMNEEYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFV 173

  Fly   260 RLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIP---------FVFVDVGGQRTQRQKWTRCFD 315
            |::..:|:|:.:||||.||.|.|:.:...:|. ||         |...||||||.||.||.:.|:
  Fly   174 RISDAEYIPSTEDILHSRKITTGISQITFRVP-IPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFE 237

  Fly   316 SSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCN 380
             .:.:::||:|.|||||.|.||...|||:|:..:|..:..|.......:|:||||.|::|:|: .
  Fly   238 -GIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKI-R 300

  Fly   381 PETDIRWYYPHF--------NGNPHSVLD-VQNFILQMFMSVRR-------------SSSISRIY 423
            ....|..|:|.:        ..|.....| .:.||.|..:.:.:             .:|....|
  Fly   301 AGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECY 365

  Fly   424 HHFTTAIDTRNINVVFNSVKDTILQRNLNALML 456
            :|||.|.|||.|..||..|:..||..|::::.|
  Fly   366 YHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 126/355 (35%)
G-alpha 133..451 CDD:206639 125/351 (36%)
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 126/355 (35%)
G-alpha 48..392 CDD:206639 125/350 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63213at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.