DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnai2a

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001001818.1 Gene:gnai2a / 336421 ZFINID:ZDB-GENE-030131-8365 Length:355 Species:Danio rerio


Alignment Length:348 Identity:139/348 - (39%)
Similarity:204/348 - (58%) Gaps:23/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....::|||||||||||||||.:|||:|||...:..|...:|::|::.|.|:
Zfish    15 RSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECKQYRAVVFSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLD---VPKFMEYAPPISRLWQDRGIRRAFE 240
            .:..::.|...|.|.:....|..||.....:...:.:   :|.  |.|..|.|||.|||::..|.
Zfish    80 SIMAIVKAMTSLKIEYEDSARADDARQLFALSGTAEEQGILPD--ELANVICRLWADRGVQNCFT 142

  Fly   241 RRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRT 305
            |.||:|::||.:|:|::::|:|..||:||.:|:|..|..|.|:.|.....:::.|...||||||:
Zfish   143 RAREYQLNDSAAYYLNDMERIAKADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRS 207

  Fly   306 QRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNK 370
            :|:||..||: .||:|||.|:.|.:|.|||||.:.||:.||..:||:|.||..|...||||||||
Zfish   208 ERKKWIHCFE-GVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNK 271

  Fly   371 TDLLEQK-------VCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTT 428
            .||.|||       :|.||      ||    ...:..:...:|...|..:.:......||.|||.
Zfish   272 KDLFEQKITRSSLIICFPE------YP----GEDNYEEASEYIRTKFEDLNKKKETKEIYPHFTC 326

  Fly   429 AIDTRNINVVFNSVKDTILQRNL 451
            |.||:|:..||::|.|.|::.||
Zfish   327 ATDTKNVQFVFDAVTDVIIKNNL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 139/348 (40%)
G-alpha 133..451 CDD:206639 132/327 (40%)
gnai2aNP_001001818.1 G_alpha 14..353 CDD:214595 139/348 (40%)
G-alpha 34..349 CDD:206639 132/327 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.