DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gna14

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001013169.1 Gene:Gna14 / 309242 RGDID:1308122 Length:355 Species:Rattus norvegicus


Alignment Length:366 Identity:157/366 - (42%)
Similarity:223/366 - (60%) Gaps:16/366 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCGNIITYLVRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRII 155
            ||           .:.||.|.:..|.||::.|.::|...||::||||||.||||||||:||||||
  Rat     5 CC-----------LSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRII 58

  Fly   156 HGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM 220
            ||..:..|....:..::|||:...||.::.|.:.|.|.:..:..:::|...:.:|.:.:.... .
  Rat    59 HGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSAIS-R 122

  Fly   221 EYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYE 285
            :....|.:||.|.||:..::||||:|:|||..|:|.:|.|:|.|.:|||.:|:|..|..|.|:.|
  Rat   123 DQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRVPTTGIIE 187

  Fly   286 FCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIF 350
            :...::||.|..|||||||::|:||..||: |||||||||:.||:||||||....||:||||.:|
  Rat   188 YPFDLENIIFRMVDVGGQRSERRKWIHCFE-SVTSIIFLVALSEYDQVLAECDNENRMEESKALF 251

  Fly   351 DTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRR 415
            .||:....|...|:||||||.||||:|:.  .:.:..|:|.:.|....|...::|||:::.. :.
  Rat   252 KTIITYPWFLNSSVILFLNKKDLLEEKIM--YSHLISYFPEYTGPKQDVKAARDFILKLYQD-QN 313

  Fly   416 SSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLNALML 456
            ......||.|||.|.||.||..||.:|||||||.||....|
  Rat   314 PDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 151/342 (44%)
G-alpha 133..451 CDD:206639 142/317 (45%)
Gna14NP_001013169.1 G_alpha 16..353 CDD:214595 151/341 (44%)
G-alpha 36..349 CDD:206639 142/317 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.