DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gnat3

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_775162.1 Gene:Gnat3 / 286924 RGDID:727817 Length:354 Species:Rattus norvegicus


Alignment Length:349 Identity:136/349 - (38%)
Similarity:207/349 - (59%) Gaps:12/349 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSV 171
            |..|...:|||::|.|:::.....|.|||||||||||||||.:|||:|||...:..:..:|:::|
  Rat     8 ESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSKQECMEFKAV 72

  Fly   172 IYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLD----VPKFMEYAPPISRLWQD 232
            :|.|.::.:..::.|...|.|.: .:.|.::.....|...|:|:    .|:..|.   |.|||.|
  Rat    73 VYSNTLQSILAIVKAMTTLGIDY-VNPRSREDQQLLLSMANTLEDGDMTPQLAEI---IKRLWGD 133

  Fly   233 RGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVF 297
            .||:..|||..|:|::||.:|:|:::.||..|.|||..:|:||.|..|.|:.|.....:::.|..
  Rat   134 PGIQACFERASEYQLNDSAAYYLNDLDRLTAPGYVPNEQDVLHSRVKTTGIIETQFSFKDLNFRM 198

  Fly   298 VDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGI 362
            .||||||::|:||..||: .||.|||..:.|.:|.||.||.:.||:.||.::|::|.|:..|...
  Rat   199 FDVGGQRSERKKWIHCFE-GVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFATT 262

  Fly   363 SIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFT 427
            ||:|||||.||.::||......|  .:|.:.| |::..|..|:|...|:.:........||.|.|
  Rat   263 SIVLFLNKKDLFQEKVTKVHLSI--CFPEYTG-PNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMT 324

  Fly   428 TAIDTRNINVVFNSVKDTILQRNL 451
            .|.||:|:..||::|.|.|::.||
  Rat   325 CATDTQNVKFVFDAVTDIIIKENL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 134/344 (39%)
G-alpha 133..451 CDD:206639 126/321 (39%)
Gnat3NP_775162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/18 (39%)
G-alpha 34..348 CDD:206639 126/321 (39%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 5/6 (83%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.