DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and GNAL

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_892023.1 Gene:GNAL / 2774 HGNCID:4388 Length:458 Species:Homo sapiens


Alignment Length:380 Identity:130/380 - (34%)
Similarity:194/380 - (51%) Gaps:67/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQ 174
            |.|..|:.||:.|..:|...::..:|||||||||||||.:|||||:|...|:.|           
Human    97 EARKVSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPE----------- 150

  Fly   175 NVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKF-------------------- 219
               ...|.:||.|:.:          :||. ..::...|..:|..                    
Human   151 ---EKKQKILDIRKNV----------KDAI-VTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPI 201

  Fly   220 ------MEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRK 278
                  .|:...:.:||.|.|::..|||..|:|:.|...|||:.|..::..||.||.:|:|.||.
Human   202 TDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRV 266

  Fly   279 ATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRL 343
            .|.|::|...:|..:.|...||||||.:|:||.:|| :.||:||::.:.|.::.|:.||..||||
Human   267 LTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCF-NDVTAIIYVAACSSYNMVIREDNNTNRL 330

  Fly   344 EESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF------------NGNP 396
            .||.::|::|.||...:.|||||||||.|:|.:||...::.|..|:|.:            .|..
Human   331 RESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGED 395

  Fly   397 HSVLDVQNFILQMFMSVRRSSSISR--IYHHFTTAIDTRNINVVFNSVKDTILQR 449
            ..|...:.||..:|:.:..::...:  .|.|||.|:||.||..|||..:| |:||
Human   396 PKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRD-IIQR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 129/378 (34%)
G-alpha 133..451 CDD:206639 123/357 (34%)
GNALNP_892023.1 G_alpha 99..455 CDD:214595 129/378 (34%)
G-alpha 120..452 CDD:206639 123/357 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.