DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and GNAI3

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_006487.1 Gene:GNAI3 / 2773 HGNCID:4387 Length:354 Species:Homo sapiens


Alignment Length:338 Identity:135/338 - (39%)
Similarity:208/338 - (61%) Gaps:4/338 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....::|||||||||||||||.:|||:|||...:..:...:|:.|:|.|.|:
Human    15 RSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFMEYAPPISRLWQDRGIRRAFERRR 243
            .:..::.|..:|.|.:|...|..||....::..::.:.....|.|..|.|||:|.|::..|.|.|
Human    80 SIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR 144

  Fly   244 EFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQ 308
            |:|::||.||:|:::.|::..:|:||.:|:|..|..|.|:.|.....:::.|...||||||::|:
Human   145 EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERK 209

  Fly   309 KWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDL 373
            ||..||: .||:|||.|:.|::|.|||||.:.||:.||..:||:|.||..|...||||||||.||
Human   210 KWIHCFE-GVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDL 273

  Fly   374 LEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNINVV 438
            .|:|:  ..:.:...||.:.|: ::..:...:|...|..:.|......||.|||.|.||:|:..|
Human   274 FEEKI--KRSPLTICYPEYTGS-NTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFV 335

  Fly   439 FNSVKDTILQRNL 451
            |::|.|.|::.||
Human   336 FDAVTDVIIKNNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 135/338 (40%)
G-alpha 133..451 CDD:206639 128/317 (40%)
GNAI3NP_006487.1 G-alpha 34..348 CDD:206639 128/317 (40%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.