DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and GNAI1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_002060.4 Gene:GNAI1 / 2770 HGNCID:4384 Length:354 Species:Homo sapiens


Alignment Length:340 Identity:140/340 - (41%)
Similarity:210/340 - (61%) Gaps:8/340 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....|:|||||||||||||||.:|||:|||...:..|...:|::|:|.|.|:
Human    15 RSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM--EYAPPISRLWQDRGIRRAFER 241
            .:..::.|..:|.|.:|...|..||  .:|..........||  |.|..|.|||:|.|::..|.|
Human    80 SIIAIIRAMGRLKIDFGDSARADDA--RQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNR 142

  Fly   242 RREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQ 306
            .||:|::||.:|:|:::.|:|.|:|:||.:|:|..|..|.|:.|.....:::.|...||||||::
Human   143 SREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSE 207

  Fly   307 RQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKT 371
            |:||..||: .||:|||.|:.|::|.|||||.:.||:.||..:||:|.||..|...||||||||.
Human   208 RKKWIHCFE-GVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK 271

  Fly   372 DLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNIN 436
            ||.|:|:  .::.:...||.:.|: ::..:...:|...|..:.:......||.|||.|.||:|:.
Human   272 DLFEEKI--KKSPLTICYPEYAGS-NTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQ 333

  Fly   437 VVFNSVKDTILQRNL 451
            .||::|.|.|::.||
Human   334 FVFDAVTDVIIKNNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 140/340 (41%)
G-alpha 133..451 CDD:206639 132/319 (41%)
GNAI1NP_002060.4 G-alpha 34..348 CDD:206639 132/319 (41%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.