DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gpa2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_593803.1 Gene:gpa2 / 2541720 PomBaseID:SPAC23H3.13c Length:354 Species:Schizosaccharomyces pombe


Alignment Length:357 Identity:122/357 - (34%)
Similarity:195/357 - (54%) Gaps:29/357 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSV 171
            |..|.:..:.:|:|.:|......::..|:|||||.:|||||..||::|::...|..|.::.:..|
pombe     9 ESGESKKLNSKIEKQIENASKKDKKIYKVLLLGASDSGKSTISKQIKILNKNGFSQEEIMTFIPV 73

  Fly   172 IYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKF---------MEYAPPIS 227
            |.:|::...:.|:    |:.:..|.:......::.:::|       ||         ......|:
pombe    74 IRRNLLESAKTLV----KIIVQKGINLDPLGTHNCEIIE-------KFNPTPGELINANIGQAIT 127

  Fly   228 RLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQN 292
            .||....: |:.....:..:.||..||......:.:..||||..|||..|.:|.|:.|....:.:
pombe   128 SLWSANSV-RSCTYGNDSVLIDSAPYFFSRADEICSRHYVPTIDDILRSRNSTLGISEISFTLDH 191

  Fly   293 IPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDR--KTNRLEESKNIFDTIVN 355
            :.....|||||||:|:||..||: :|.||||.||.:::|:.|.|..  :.|||.||.::||:|:|
pombe   192 LQIRMFDVGGQRTERRKWIYCFE-NVNSIIFCVSLNDYDKKLYERAAPERNRLVESISLFDSIIN 255

  Fly   356 NATFKGISIILFLNKTDLLEQKVCN-PETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSI 419
            :..|...||||||||.||..:|:.: |..|   |:|.:.|. :||..:..:||.:|::...:.:.
pombe   256 SQWFMHSSIILFLNKFDLFRKKLEHVPFQD---YFPQYEGK-NSVKSITRYILWLFVNPSINRAK 316

  Fly   420 SRIYHHFTTAIDTRNINVVFNSVKDTILQRNL 451
            ..||.|.|||:||.||.|||::||:||||.:|
pombe   317 HNIYPHITTAVDTSNIKVVFSAVKETILQHSL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 120/352 (34%)
G-alpha 133..451 CDD:206639 116/329 (35%)
gpa2NP_593803.1 G_alpha 14..352 CDD:214595 120/352 (34%)
G-alpha 35..348 CDD:206639 116/329 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.