DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gnas

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_038960221.1 Gene:Gnas / 24896 RGDID:2716 Length:1145 Species:Rattus norvegicus


Alignment Length:394 Identity:146/394 - (37%)
Similarity:210/394 - (53%) Gaps:54/394 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RLRSTPEELEQR-------YKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGV 158
            |.:...|.:|.|       .:||.|||.||:||..:....:|||||||||||||.:|||||:|..
  Rat   752 RKQMRKEAMEMREQKRADKKRSKLIDKQLEEEKMDYMCTHRLLLLGAGESGKSTIVKQMRILHVN 816

  Fly   159 NFD-----------------YELLLEYQSV------IYQNVIRGMQVLLDAREKLNIAWGSDGRE 200
            .|:                 .|...:.|.:      ..:.::..|..|:...|..|    .:.:.
  Rat   817 GFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELAN----PENQF 877

  Fly   201 QDAYDAKLMECNSLDV-PKFMEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATP 264
            :..|...:|...:.|. |:|.|:|   ..||:|.|:|..:||..|:|:.|...||||:|..:...
  Rat   878 RVDYILSVMNVPNFDFPPEFYEHA---KALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQA 939

  Fly   265 DYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSE 329
            ||||:.:|:|.||..|.|::|...:|..:.|...||||||.:|:||.:|| :.||:|||:|:||.
  Rat   940 DYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCF-NDVTAIIFVVASSS 1003

  Fly   330 FDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF-- 392
            ::.|:.||.:||||:|:.|:|.:|.||...:.||:||||||.|||.:||...::.|..|:|.|  
  Rat  1004 YNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFAR 1068

  Fly   393 ----------NGNPHSVLDVQNFILQMFMSVRRSSSISR--IYHHFTTAIDTRNINVVFNSVKDT 445
                      .|....|...:.||...|:.:..:|...|  .|.|||.|:||.||..|||..:| 
  Rat  1069 YTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRD- 1132

  Fly   446 ILQR 449
            |:||
  Rat  1133 IIQR 1136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 143/383 (37%)
G-alpha 133..451 CDD:206639 133/355 (37%)
GnasXP_038960221.1 PHA03247 <122..560 CDD:223021
UDM1_RNF168_RNF169-like 741..>783 CDD:409016 11/30 (37%)
G-alpha 791..1139 CDD:206639 133/355 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.