DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gnal

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001178765.1 Gene:Gnal / 24611 RGDID:2715 Length:450 Species:Rattus norvegicus


Alignment Length:442 Identity:144/442 - (32%)
Similarity:212/442 - (47%) Gaps:92/442 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PEAATTST-----DGLISNGAER-LRLQGSRLQTSRFACFRCCGNIITYLVRLRSTPEEL--EQR 112
            |..|...|     ||.|...|.. :.||..|.|.                 :||:...|.  |.|
  Rat    44 PAPAPVGTLLRRGDGRIPASARSPVELQNRRRQE-----------------QLRAEEREAAKEAR 91

  Fly   113 YKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVI 177
            ..|:.||:.|.::|...::..:|||||||||||||.:|||||:|...|:.|              
  Rat    92 KVSRGIDRMLREQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPE-------------- 142

  Fly   178 RGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKF----------------------- 219
            ...|.:||.|:.:          :||. ..::...|..:|..                       
  Rat   143 EKKQKILDIRKNV----------KDAI-VTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDF 196

  Fly   220 ---MEYAPPISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATK 281
               .|:...:.:||.|.|::..|||..|:|:.|...|||:.|..::..||.||.:|:|.||..|.
  Rat   197 EYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTS 261

  Fly   282 GVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEES 346
            |::|...:|..:.|...||||||.:|:||.:|| :.||:||::.:.|.::.|:.||..||||.||
  Rat   262 GIFETRFQVDKVNFHMFDVGGQRDERRKWIQCF-NDVTAIIYVAACSSYNMVIREDNNTNRLRES 325

  Fly   347 KNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF------------NGNPHSV 399
            .::|::|.||...:.|||||||||.|:|.:||...::.|..|:|.:            .|....|
  Rat   326 LDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKV 390

  Fly   400 LDVQNFILQMFMSVRRSSSISR--IYHHFTTAIDTRNINVVFNSVKDTILQR 449
            ...:.||..:|:.:..::...:  .|.|||.|:||.||..|||..:| |:||
  Rat   391 TRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRD-IIQR 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 129/378 (34%)
G-alpha 133..451 CDD:206639 123/357 (34%)
GnalNP_001178765.1 G_alpha 93..447 CDD:214595 128/376 (34%)
G-alpha 112..444 CDD:206639 123/357 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.