DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gpa-9

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001256444.1 Gene:gpa-9 / 191659 WormBaseID:WBGene00001671 Length:96 Species:Caenorhabditis elegans


Alignment Length:93 Identity:33/93 - (35%)
Similarity:50/93 - (53%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 FKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIY 423
            |...:|||||||.||.|.|:.:  |:|...:|.:.| |........:|...|:|:..:.: .:||
 Worm     3 FHSTAIILFLNKIDLFEIKITH--TNITVAFPDYEG-PRERDCALEYIRVQFISLNNNKN-RKIY 63

  Fly   424 HHFTTAIDTRNINVVFNSVKDTILQRNL 451
            .|.|:|.||..|.||.:.:.|.|:..:|
 Worm    64 QHVTSATDTARIQVVIDMLFDIIISASL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 33/93 (35%)
G-alpha 133..451 CDD:206639 32/91 (35%)
gpa-9NP_001256444.1 P-loop_NTPase <2..91 CDD:304359 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.