DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gpa-18

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001293719.1 Gene:gpa-18 / 189161 WormBaseID:WBGene00020997 Length:320 Species:Caenorhabditis elegans


Alignment Length:331 Identity:65/331 - (19%)
Similarity:128/331 - (38%) Gaps:77/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RRQVKLLLLGAGESGKSTFLKQM-----------RIIHGVNFDYELLLEYQSVIYQNVIRGMQVL 183
            |..::.|:||...:||::|::||           |.::.......||..|:.:  :|||..:::.
 Worm     9 RGPIRTLVLGCMGAGKTSFIRQMVKNHTKSICLRRELYLYCVQLNLLNIYREL--KNVIEALEIP 71

  Fly   184 LDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFMEYAPPISRLWQDRGIRRAFE-------- 240
            :...:|.......:.|.::.:..|::|                       .::..||        
 Worm    72 ISEDQKQRFTQLDEYRHREVFPPKIIE-----------------------AMKELFESGLYELCR 113

  Fly   241 -RRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQR 304
             |:|...:..:..:..........|:|||:..:|:.....|.|:....|..|...|..:::.|..
 Worm   114 LRQRILPLPQNYHFLFQRGDDFMNPEYVPSELEIMMSYSQTCGLNRENVTCQGYKFELLEMPGHH 178

  Fly   305 TQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNR--LE-ESKNIFDTIVNNATFKGISIIL 366
            ..|.||...||.. ..::|::..||    |.:....|:  || ::..:|:::|||.....:..:|
 Worm   179 LWRAKWADYFDDP-NLVVFVIDLSE----LCDPAFYNKGYLENKTVTVFESLVNNPVLAKVYWLL 238

  Fly   367 FLNKTDLLE--------QKVCN----PETDIRWYYPHFNGN-------PHSV-----LDVQNFIL 407
            ..||.|...        :|:.|    .::...:|...|...       ||.|     .:.|:.::
 Worm   239 LFNKADTFNDHSAGFDFRKLANHLDTADSARSFYRSQFTTKISKTRCFPHIVSLVNFKESQSVMM 303

  Fly   408 QMFMSV 413
            :||..:
 Worm   304 EMFKKI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 65/331 (20%)
G-alpha 133..451 CDD:206639 64/328 (20%)
gpa-18NP_001293719.1 G-alpha 12..309 CDD:278904 64/326 (20%)
P-loop_NTPase 12..289 CDD:304359 59/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.