DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gpa-2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_505157.1 Gene:gpa-2 / 179219 WormBaseID:WBGene00001664 Length:356 Species:Caenorhabditis elegans


Alignment Length:355 Identity:122/355 - (34%)
Similarity:191/355 - (53%) Gaps:10/355 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLL 166
            |..:.||.....||:.|||.:::.:.:..|.||||||||||.||||.|||||::....:..|.||
 Worm     3 LCQSEEEKVGTLKSRAIDKEIKQLQTSEERTVKLLLLGAGECGKSTVLKQMRLLTSKQYTDEELL 67

  Fly   167 EYQSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKF-MEYAPPISRLW 230
            ....::|.|::..|..|:.|.....:.:....||.|.:...|. ...:....| .:.|..:.:||
 Worm    68 TQAKLVYTNIVIEMDHLVKAMPAAGLNFSDPMREHDVHMLTLY-IKDMQHKNFQQDAADHVEKLW 131

  Fly   231 QDRGIRRAFERRREF---QISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQN 292
            :|..::|.:..|:|.   .|.|:..||.:.:.|::..||.|...|.|..|..|.|:.|...:::.
 Worm   132 KDPVVKRLYAERKELNIRDIGDNTEYFFENLPRISKEDYHPNATDTLLLRTKTTGIVEVGFEIKK 196

  Fly   293 IPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNA 357
            :.|...||||||::|:||..||: .|.:|||:.:.||:::||.||..|||:.||..:|::|.|:.
 Worm   197 VKFRVFDVGGQRSERKKWIHCFE-DVNAIIFIAALSEYNEVLFEDETTNRMIESMRLFESICNSR 260

  Fly   358 TFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRI 422
            .|...:|||||||.||.|:|:  .:.:|...:|.:.|. .:..:...||...|.::..:.. ...
 Worm   261 WFHNTNIILFLNKKDLFEEKI--KKENIHKAFPEYRGE-QNYAETVAFIKTKFEALSNNPK-KTF 321

  Fly   423 YHHFTTAIDTRNINVVFNSVKDTILQRNLN 452
            |.|.|.|.||..:..:.:||...|:|.||:
 Worm   322 YVHETCATDTNQVQKILDSVISMIIQSNLH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 119/345 (34%)
G-alpha 133..451 CDD:206639 111/321 (35%)
gpa-2NP_505157.1 G_alpha 13..354 CDD:214595 119/345 (34%)
G-alpha 34..350 CDD:206639 111/321 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.