DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and Gnai1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_034435.1 Gene:Gnai1 / 14677 MGIID:95771 Length:354 Species:Mus musculus


Alignment Length:340 Identity:140/340 - (41%)
Similarity:210/340 - (61%) Gaps:8/340 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....|:|||||||||||||||.:|||:|||...:..|...:|::|:|.|.|:
Mouse    15 RSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM--EYAPPISRLWQDRGIRRAFER 241
            .:..::.|..:|.|.:|...|..||  .:|..........||  |.|..|.|||:|.|::..|.|
Mouse    80 SIIAIIRAMGRLKIDFGDSARADDA--RQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNR 142

  Fly   242 RREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQ 306
            .||:|::||.:|:|:::.|:|.|:|:||.:|:|..|..|.|:.|.....:::.|...||||||::
Mouse   143 SREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSE 207

  Fly   307 RQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKT 371
            |:||..||: .||:|||.|:.|::|.|||||.:.||:.||..:||:|.||..|...||||||||.
Mouse   208 RKKWIHCFE-GVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK 271

  Fly   372 DLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNIN 436
            ||.|:|:  .::.:...||.:.|: ::..:...:|...|..:.:......||.|||.|.||:|:.
Mouse   272 DLFEEKI--KKSPLTICYPEYAGS-NTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQ 333

  Fly   437 VVFNSVKDTILQRNL 451
            .||::|.|.|::.||
Mouse   334 FVFDAVTDVIIKNNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 140/340 (41%)
G-alpha 133..451 CDD:206639 132/319 (41%)
Gnai1NP_034435.1 G-alpha 34..348 CDD:206639 132/319 (41%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 3/7 (43%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.