DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnat2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_571944.1 Gene:gnat2 / 140429 ZFINID:ZDB-GENE-011128-10 Length:354 Species:Danio rerio


Alignment Length:351 Identity:135/351 - (38%)
Similarity:218/351 - (62%) Gaps:10/351 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 STPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEY 168
            ::.|:.|...||||::|.|:::.....:.|||||||||||||||.:|||:|:|...:..|..:|:
Zfish     5 ASAEDKEMAKKSKELEKQLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKILHQGGYTKEEQMEF 69

  Fly   169 QSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLD---VPKFMEYAPPISRLW 230
            :|:|:.|:::....::...|.|:|.:||...::|:...:.:. :|::   :|.  |.|..|.|||
Zfish    70 RSIIFGNILQSALAIIRGMEMLSINFGSPSAQEDSQKLQNLS-DSIEEGTMPP--ELADVIKRLW 131

  Fly   231 QDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPF 295
            :|.|::.:|:|..|:|::||..|:|:|:.|:..|||:||.:|:|..|..|.|:.|.....:.:.|
Zfish   132 KDAGVQASFDRAAEYQLNDSAGYYLNEMDRICKPDYLPTEQDVLRSRVKTTGIIEEQFGCKELHF 196

  Fly   296 VFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFK 360
            ...||||||::|:||..||: .||.|||..:.|.:|.||.||.:.||:.||.::|::|.|:..|.
Zfish   197 RMFDVGGQRSERKKWIHCFE-GVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFA 260

  Fly   361 GISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHH 425
            ..||:|||||.||.::|:......|  .:|.::| |::..|..|:|...|..:.....:..||.|
Zfish   261 TTSIVLFLNKKDLFQEKIKKVHLSI--CFPDYDG-PNTYEDASNYIKTQFQDLNMKKGVKEIYSH 322

  Fly   426 FTTAIDTRNINVVFNSVKDTILQRNL 451
            .|.|.||:|:.:|||:|.|.|::.||
Zfish   323 MTCATDTKNVEIVFNAVTDIIIKENL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 133/343 (39%)
G-alpha 133..451 CDD:206639 125/320 (39%)
gnat2NP_571944.1 G_alpha 13..352 CDD:214595 133/343 (39%)
G-alpha 34..348 CDD:206639 125/320 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.