DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnat1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_571943.1 Gene:gnat1 / 140428 ZFINID:ZDB-GENE-011128-11 Length:350 Species:Danio rerio


Alignment Length:346 Identity:137/346 - (39%)
Similarity:214/346 - (61%) Gaps:13/346 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQ 174
            |::: |:|::|.|:::.....|.|||||||||||||||.:|||:|||...:..|..||:..:||.
Zfish     8 EEKH-SRELEKKLKEDADKDARTVKLLLLGAGESGKSTIVKQMKIIHKDGYSLEECLEFIVIIYS 71

  Fly   175 NVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLME-CNSLD---VPKFMEYAPPISRLWQDRGI 235
            |.::.:..::.|...|||.:|....:.||  .|||. .::::   :||  |.:..|.|||:|.||
Zfish    72 NTMQSILAVVRAMTTLNIGYGDAAAQDDA--RKLMHLADTIEEGTMPK--ELSDIILRLWKDSGI 132

  Fly   236 RRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDV 300
            :..|:|..|:|::||..|:|::::||..|.||||.:|:|..|..|.|:.|.....:::.|...||
Zfish   133 QACFDRASEYQLNDSAGYYLNDLERLIQPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDV 197

  Fly   301 GGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISII 365
            ||||::|:||..||: .||.|||:.:.|.:|.||.||.:.||:.||.::|::|.|:..|...||:
Zfish   198 GGQRSERKKWIHCFE-GVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIV 261

  Fly   366 LFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAI 430
            |||||.|:..:|:  .:..:...:|.::| |::..|..|:|...|:.:.....|..||.|.|.|.
Zfish   262 LFLNKKDVFVEKI--KKAHLSMCFPEYDG-PNTFEDAGNYIKVQFLDLNLRRDIKEIYSHMTCAT 323

  Fly   431 DTRNINVVFNSVKDTILQRNL 451
            ||.|:..||::|.|.|::.||
Zfish   324 DTENVKFVFDAVTDIIIKENL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 136/344 (40%)
G-alpha 133..451 CDD:206639 129/321 (40%)
gnat1NP_571943.1 G_alpha 9..348 CDD:214595 136/345 (39%)
G-alpha 30..344 CDD:206639 129/321 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.