DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gna15

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_002934852.2 Gene:gna15 / 100496529 XenbaseID:XB-GENE-1011753 Length:373 Species:Xenopus tropicalis


Alignment Length:356 Identity:139/356 - (39%)
Similarity:211/356 - (59%) Gaps:16/356 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSV 171
            ||......::||::.|:.:|...|.::|:||||.||||||||:||||||||..|..:....|..:
 Frog    17 EETTALTVNREIERILKLQKERSRGEIKVLLLGTGESGKSTFIKQMRIIHGAGFSEQERKFYARL 81

  Fly   172 IYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFME-YAPPISRLWQDRGI 235
            ::||::...|.|:.|.|.|.:.:..:..:.:.  .|:.|.::..:....| |...|..||.|.||
 Frog    82 VHQNIVTCAQSLVGAMETLQVPYSIENNQING--RKISELDAFRIQAIEEPYVKAIKNLWSDTGI 144

  Fly   236 RRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDV 300
            :|.:|||||||:.||.:|:|..::||....|.||.:|||..|..|.|:.|:...|:|:....|||
 Frog   145 QRCYERRREFQLLDSTNYYLSNLERLTQDMYQPTDEDILRIRMPTTGINEYSFPVENMNLRMVDV 209

  Fly   301 GGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISII 365
            |||:::|:||...|: :|:::|:|.|.||:||.|.|:...||::||..:|..|:....|:...||
 Frog   210 GGQKSERRKWIHSFE-NVSALIYLASLSEYDQRLEENCHDNRMKESLALFRNILELPWFQETPII 273

  Fly   366 LFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFIL----QMFMSVRRSSSIS------ 420
            ||||||||||:|:.  .:|:..|:..|.|........:.|||    ::|..:|:..:..      
 Frog   274 LFLNKTDLLEEKIA--FSDLANYFHRFKGPCRDAEAAKQFILDNYKEIFNKIRKQDASGKDDLKH 336

  Fly   421 RIYHHFTTAIDTRNINVVFNSVKDTILQRNL 451
            ::|||||.|.||.||..|||:||:.:|.:.|
 Frog   337 KVYHHFTCATDTDNIRKVFNNVKEAVLVKYL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 137/351 (39%)
G-alpha 133..451 CDD:206639 131/328 (40%)
gna15XP_002934852.2 G-alpha 43..363 CDD:206639 130/324 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.