DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnal

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_012819842.2 Gene:gnal / 100216229 XenbaseID:XB-GENE-480551 Length:501 Species:Xenopus tropicalis


Alignment Length:369 Identity:138/369 - (37%)
Similarity:211/369 - (57%) Gaps:25/369 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VRLRSTPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYEL 164
            :||.....|.|.:..||.||:.|:::|..:::..:|||||||||||||.:|||||:|...|:.|.
 Frog   130 LRLEEKEAEKEAKKVSKSIDRVLKEQKREYKQTHRLLLLGAGESGKSTIVKQMRILHVNGFNSEE 194

  Fly   165 LLEYQSVIYQNVIRGMQVLLDAREKL----NIAWGSDGREQDAYDAKLMECNSLD-VPKFMEYAP 224
            ..:....|.:||...:..::.|...|    ::| .|:.:.:..|...:...:..| ..:|.::| 
 Frog   195 KKQKIQDIRKNVKDAIVTIVSAMSTLIPPVSLA-NSENQFRVDYIKSIAPLSDFDYTQEFFDHA- 257

  Fly   225 PISRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVK 289
              .:||.|.|::..|||..|:|:.|...|||:.|..:...||.||.:|:|.||..|.|::|...:
 Frog   258 --QKLWDDDGVKACFERSNEYQLIDCAQYFLERIDHVRQNDYTPTDQDLLRCRVLTSGIFETRFQ 320

  Fly   290 VQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIV 354
            |..:.|...||||||.:|:||.:|| :.||:|||:|:||.::.|:.||..||||.|:.::|.:|.
 Frog   321 VDKVNFHMFDVGGQRDERRKWIQCF-NDVTAIIFVVASSSYNMVIREDNNTNRLREALDLFKSIW 384

  Fly   355 NNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF-------NGNPHS-----VLDVQNFIL 407
            ||...:.||:||||||.|:|.:||...::.|..|:|.:       :.:|.:     |...:.||.
 Frog   385 NNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYVRYTVPDDVSPDTEEDPKVTRAKFFIR 449

  Fly   408 QMFMSVRRSSSISR--IYHHFTTAIDTRNINVVFNSVKDTILQR 449
            ..|:.:..:|...|  .|.|||.|:||.||..|||..:| |:||
 Frog   450 DEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRD-IIQR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 134/357 (38%)
G-alpha 133..451 CDD:206639 128/336 (38%)
gnalXP_012819842.2 G-alpha 163..495 CDD:206639 128/336 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.