DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnat2

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001135577.1 Gene:gnat2 / 100216126 XenbaseID:XB-GENE-6258657 Length:354 Species:Xenopus tropicalis


Alignment Length:353 Identity:131/353 - (37%)
Similarity:215/353 - (60%) Gaps:14/353 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 STPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEY 168
            ::.|:.|...:|||::|.|:::.....:.|||||||||||||||.:|||:|||...:..:..:|:
 Frog     5 ASAEDKELAKRSKELEKKLQEDAAMDAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSEQECIEF 69

  Fly   169 QSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLME--CNSLD---VPKFMEYAPPISR 228
            :::||.|:::.:..::.|...|.|.:|...|   |.|.:::.  .:|::   :|:  |....|.:
 Frog    70 RAIIYGNILQSILAIIRAMSTLGIDYGDSSR---ADDGRILSHLADSIEEGTMPQ--ELVDVIKK 129

  Fly   229 LWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNI 293
            ||:|.|::..|||..|:|::||.:|:|:::.|:...:|:|..:|:|..|..|.|:.|.....:::
 Frog   130 LWKDDGVQACFERAAEYQLNDSAAYYLNQLDRITASNYIPNEQDVLRSRVKTTGIIESQFSFKDL 194

  Fly   294 PFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNAT 358
            .|...||||||::|:||..||: .||.|||..:.|.:|.||.||.:.||:.||.::|::|.|:..
 Frog   195 HFRMFDVGGQRSERKKWIHCFE-GVTCIIFCGALSAYDMVLVEDEEVNRMHESLHLFNSICNHKF 258

  Fly   359 FKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIY 423
            |...||:|||||.||.|||:......|  .:|.::| |::..|..|:|.|.|:.:........||
 Frog   259 FAATSIVLFLNKKDLFEQKIKKVHLSI--CFPDYDG-PNTFDDAGNYIKQQFLDLNMRKDSKEIY 320

  Fly   424 HHFTTAIDTRNINVVFNSVKDTILQRNL 451
            .|.|.|.||:|:..||::|.|.|::..|
 Frog   321 GHMTCATDTQNVKFVFDAVTDIIIKETL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 129/345 (37%)
G-alpha 133..451 CDD:206639 123/322 (38%)
gnat2NP_001135577.1 G-alpha 34..348 CDD:206639 123/322 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.