DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnai1

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001090865.1 Gene:gnai1 / 100038283 XenbaseID:XB-GENE-942094 Length:354 Species:Xenopus tropicalis


Alignment Length:347 Identity:142/347 - (40%)
Similarity:205/347 - (59%) Gaps:22/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            :||.||:.|.::.....|:|||||||||||||||.:|||:|||...:..|...:|::|:|.|.|:
 Frog    15 RSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFM--EYAPPISRLWQDRGIRRAFER 241
            .:..::.|..:|.|.:|...|..||  .:|..........||  |.|..|.|||:|.|::..|.|
 Frog    80 SIIAIIRAMGRLKIDFGDPSRADDA--RQLFVLAGAAEEGFMTAELAGVIKRLWKDGGVQACFNR 142

  Fly   242 RREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQ 306
            .||:|::||.:|:|:::.|:|...|:||.:|:|..|..|.|:.|.....:::.|...||||||::
 Frog   143 SREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSE 207

  Fly   307 RQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKT 371
            |:||..||: .||:|||.|:.|::|.|||||.:.||:.||..:||:|.||..|...||||||||.
 Frog   208 RKKWIHCFE-GVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKK 271

  Fly   372 DLLEQK-------VCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTA 429
            ||.|:|       :|.||      ||..|    :..:...:|...|..:.:......||.|||.|
 Frog   272 DLFEEKIKRSPLTICYPE------YPGSN----TYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCA 326

  Fly   430 IDTRNINVVFNSVKDTILQRNL 451
            .||:|:..||::|.|.|::.||
 Frog   327 TDTKNVQFVFDAVTDVIIKNNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 142/347 (41%)
G-alpha 133..451 CDD:206639 134/326 (41%)
gnai1NP_001090865.1 G-alpha 34..348 CDD:206639 134/326 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.