DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cta and gnai3

DIOPT Version :9

Sequence 1:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001104720.1 Gene:gnai3 / 100006888 ZFINID:ZDB-GENE-070713-6 Length:354 Species:Danio rerio


Alignment Length:338 Identity:133/338 - (39%)
Similarity:204/338 - (60%) Gaps:4/338 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIR 178
            |||.||:.|.::.....|:|||||||||||||||.:|||:|||...:..:...:|:.|:|.|.|:
Zfish    15 KSKMIDRTLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQ 79

  Fly   179 GMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFMEYAPPISRLWQDRGIRRAFERRR 243
            .:..::.|..:|.|.:|...|..||....::...:.:.....:.:..|.|||:|.|::..|.|.|
Zfish    80 SIIAIIRAMGRLKIDFGDPARADDARQLFVLAGTAEEGVMTADLSGVIRRLWKDEGVQMCFVRSR 144

  Fly   244 EFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQ 308
            |:|::||.:|:|::::|::.|.|.||.:|:|..|..|.|:.|.....:.:.|...||||||::|:
Zfish   145 EYQLNDSAAYYLNDLERISQPTYTPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERK 209

  Fly   309 KWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNNATFKGISIILFLNKTDL 373
            ||..||: .||:|||.|:.|::|.|||||.:.||:.||..:||:|.||..|...|:||||||.||
Zfish   210 KWIHCFE-GVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSVILFLNKKDL 273

  Fly   374 LEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRRSSSISRIYHHFTTAIDTRNINVV 438
            .|.|:  .::.:...||.:.|. .:..:...:|...|..:.:......||.|||.|.||:|:..|
Zfish   274 FEDKI--KKSPLTICYPEYCGT-CTYEEAAAYIQCQFEDLNKRKETKEIYTHFTCATDTKNVQFV 335

  Fly   439 FNSVKDTILQRNL 451
            |::|.|.|::.||
Zfish   336 FDAVTDVIIKNNL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 133/338 (39%)
G-alpha 133..451 CDD:206639 124/317 (39%)
gnai3NP_001104720.1 G_alpha 14..352 CDD:214595 133/338 (39%)
G-alpha 34..348 CDD:206639 124/317 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.