DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17715 and Tmem65

DIOPT Version :9

Sequence 1:NP_001036410.1 Gene:CG17715 / 3355129 FlyBaseID:FBgn0041004 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006521567.1 Gene:Tmem65 / 74868 MGIID:1922118 Length:261 Species:Mus musculus


Alignment Length:254 Identity:91/254 - (35%)
Similarity:128/254 - (50%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PRGRELLRTQLIIPPSSTSSPFTCRNYSKFSTHLSMERALELLCNLDDEERGNLRSALGRLDADK 86
            |.|..||.|.      ....|....|        :.:.|.:.:.:|...||..|...|.|.::  
Mouse    42 PGGPRLLGTH------PKKEPMEALN--------TAQGARDFIYSLHSTERSCLLKELHRFES-- 90

  Fly    87 EKKLYESQLAFGSWRTRFGR----LSNKTELGQVIAGTFCAVPDDWLRKKLVETAASPTAGQLYS 147
                    :|... ..||.:    ::.:.|  :|.|   ...||.:  :||  .|..||.|||..
Mouse    91 --------IAIAQ-ACRFPKPEVVIAKRAE--EVSA---AETPDSF--EKL--EALPPTPGQLRY 137

  Fly   148 IFFVNAVPFIAFGFLDNFIMIMAGEYIEYYLGHFITLSTMAAAGLGNTISDILGITMATYVENGC 212
            :||.||:||:.||||||.|||:||..||..:|..:.:||||||.|||.:||:.|:.:|.|||...
Mouse   138 VFFHNAIPFVGFGFLDNAIMIVAGTQIELSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALA 202

  Fly   213 QILGLKQPNLTPAQFELKSSKRSSSYGRIVGITVGCLLGMCPLWFM-----DEKADKVN 266
            ..|||..|:|||.|.::..::.|:..|:.||:|:||:|||.||.|.     |||.:..|
Mouse   203 SRLGLSIPDLTPKQVDMWQTRVSTHLGKAVGVTIGCILGMFPLIFFGGSEEDEKLETTN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17715NP_001036410.1 DUF2453 151..258 CDD:287478 54/106 (51%)
Tmem65XP_006521567.1 TMEM65 141..248 CDD:371101 54/106 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834919
Domainoid 1 1.000 113 1.000 Domainoid score I6135
eggNOG 1 0.900 - - E1_KOG4619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006142
OrthoInspector 1 1.000 - - oto93003
orthoMCL 1 0.900 - - OOG6_104678
Panther 1 1.100 - - LDO PTHR21706
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4172
SonicParanoid 1 1.000 - - X4432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.