DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17715 and Tmem65

DIOPT Version :9

Sequence 1:NP_001036410.1 Gene:CG17715 / 3355129 FlyBaseID:FBgn0041004 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001094465.1 Gene:Tmem65 / 500874 RGDID:1563224 Length:261 Species:Rattus norvegicus


Alignment Length:160 Identity:71/160 - (44%)
Similarity:97/160 - (60%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PDDWLRKKLVETAAS-------------PTAGQLYSIFFVNAVPFIAFGFLDNFIMIMAGEYIEY 176
            |:..|.|:..|.:|:             ||.|||..:||.||:||:.||||||.|||:||..||.
  Rat   102 PEMVLAKRAKEVSAAETPDSFEKLEALPPTPGQLRYVFFHNAIPFVGFGFLDNAIMIVAGTQIEL 166

  Fly   177 YLGHFITLSTMAAAGLGNTISDILGITMATYVENGCQILGLKQPNLTPAQFELKSSKRSSSYGRI 241
            .:|..:.:||||||.|||.:||:.|:.:|.|||.....|||..|:|||.|.::..::.|:..|:.
  Rat   167 SIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRVSTHLGKA 231

  Fly   242 VGITVGCLLGMCPLWFM-----DEKADKVN 266
            ||:|:||:|||.||.|.     |||.:..|
  Rat   232 VGVTIGCILGMFPLIFFGGGEEDEKLETSN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17715NP_001036410.1 DUF2453 151..258 CDD:287478 54/106 (51%)
Tmem65NP_001094465.1 DUF2453 141..248 CDD:287478 54/106 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338504
Domainoid 1 1.000 113 1.000 Domainoid score I5999
eggNOG 1 0.900 - - E1_KOG4619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D573372at33208
OrthoFinder 1 1.000 - - FOG0006142
OrthoInspector 1 1.000 - - oto96557
orthoMCL 1 0.900 - - OOG6_104678
Panther 1 1.100 - - LDO PTHR21706
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4432
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.