DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17715 and tag-321

DIOPT Version :9

Sequence 1:NP_001036410.1 Gene:CG17715 / 3355129 FlyBaseID:FBgn0041004 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_501284.1 Gene:tag-321 / 177563 WormBaseID:WBGene00044325 Length:224 Species:Caenorhabditis elegans


Alignment Length:233 Identity:87/233 - (37%)
Similarity:117/233 - (50%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSPFTCRNYSKFSTHLSMERALELLCNLDDEERGNLRSALGRLDADKEKKLYESQLAFGSWRTRF 104
            ||.....|:|..|..||...|.:.|..|..|...:......||...:::.|              
 Worm    17 SSRTLLTNHSVTSIRLSTTAAFKHLDKLIIETPNDAMEIASRLTIIEQQML-------------- 67

  Fly   105 GRLSNKTELGQVIAGTFCAVPDDWLRKKLVETAASPTAGQLYSIFFVNAVPFIAFGFLDNFIMIM 169
                 |:.|            ||.|.||........|..|:..||.||::|||.||.|||.|||:
 Worm    68 -----KSAL------------DDCLTKKEDGKVEELTQEQVKGIFLVNSIPFIGFGVLDNMIMIL 115

  Fly   170 AGEYIEYYLGHFITLSTMAAAGLGNTISDILGITMATYVENGCQILGLKQPNLTPAQFELKSSKR 234
            |||||:..||..:.:||||||.|||.||||.|:.:|.|||...|.:|:|.|.||..|.:...::.
 Worm   116 AGEYIDQKLGAVLAISTMAAAALGNLISDIAGVGLAHYVEVAVQRVGIKHPVLTSQQLDSGKARF 180

  Fly   235 SSSYGRIVGITVGCLLGMCP-LWFMDEKADKVNVKDEI 271
            :::..|..|:||||||||.| |:|.|::.|:...|.|:
 Worm   181 TTNAARAAGLTVGCLLGMFPLLFFSDDEDDEKKKKKEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17715NP_001036410.1 DUF2453 151..258 CDD:287478 57/107 (53%)
tag-321NP_501284.1 DUF2453 97..204 CDD:287478 57/106 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158374
Domainoid 1 1.000 114 1.000 Domainoid score I3821
eggNOG 1 0.900 - - E1_KOG4619
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134672
Inparanoid 1 1.050 130 1.000 Inparanoid score I3218
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D573372at33208
OrthoFinder 1 1.000 - - FOG0006142
OrthoInspector 1 1.000 - - oto18418
orthoMCL 1 0.900 - - OOG6_104678
Panther 1 1.100 - - LDO PTHR21706
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4172
SonicParanoid 1 1.000 - - X4432
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.