DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17715 and TMEM65

DIOPT Version :9

Sequence 1:NP_001036410.1 Gene:CG17715 / 3355129 FlyBaseID:FBgn0041004 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_919267.2 Gene:TMEM65 / 157378 HGNCID:25203 Length:240 Species:Homo sapiens


Alignment Length:134 Identity:66/134 - (49%)
Similarity:90/134 - (67%) Gaps:2/134 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AASPTAGQLYSIFFVNAVPFIAFGFLDNFIMIMAGEYIEYYLGHFITLSTMAAAGLGNTISDILG 201
            |..||.|||..:|..||:|||.||||||.|||:||.:||..:|..:.:||||||.|||.:||:.|
Human   106 APPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAGTHIEMSIGIILGISTMAAAALGNLVSDLAG 170

  Fly   202 ITMATYVENGCQILGLKQPNLTPAQFELKSSKRSSSYGRIVGITVGCLLGMCPLWFM--DEKADK 264
            :.:|.|||.....|||..|:|||.|.::..::.|:..|:.||:|:||:|||.||.|.  .|:.:|
Human   171 LGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKAVGVTIGCILGMFPLIFFGGGEEDEK 235

  Fly   265 VNVK 268
            :..|
Human   236 LETK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17715NP_001036410.1 DUF2453 151..258 CDD:287478 55/106 (52%)
TMEM65NP_919267.2 DUF2453 120..227 CDD:287478 55/106 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144807
Domainoid 1 1.000 115 1.000 Domainoid score I6031
eggNOG 1 0.900 - - E1_KOG4619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D573372at33208
OrthoFinder 1 1.000 - - FOG0006142
OrthoInspector 1 1.000 - - oto89432
orthoMCL 1 0.900 - - OOG6_104678
Panther 1 1.100 - - LDO PTHR21706
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4172
SonicParanoid 1 1.000 - - X4432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.