DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17715 and tmem65

DIOPT Version :9

Sequence 1:NP_001036410.1 Gene:CG17715 / 3355129 FlyBaseID:FBgn0041004 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001122284.1 Gene:tmem65 / 100005403 ZFINID:ZDB-GENE-081022-99 Length:212 Species:Danio rerio


Alignment Length:133 Identity:63/133 - (47%)
Similarity:88/133 - (66%) Gaps:0/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AASPTAGQLYSIFFVNAVPFIAFGFLDNFIMIMAGEYIEYYLGHFITLSTMAAAGLGNTISDILG 201
            |:..||.||..|...||:|||.||||||.|||.||..||..:|..:.:||||||.|||.:||:.|
Zfish    78 ASRLTAAQLRYILLHNAIPFIGFGFLDNAIMIAAGTQIELSIGLTLGISTMAAAALGNLVSDLAG 142

  Fly   202 ITMATYVENGCQILGLKQPNLTPAQFELKSSKRSSSYGRIVGITVGCLLGMCPLWFMDEKADKVN 266
            :.:|.|||.....||::.|:|:|.|.::..::.||..|:.:|:.:||:|||.||.|:.::.||..
Zfish   143 LGLAGYVEALAVRLGMQIPDLSPRQVDMWQTRVSSHMGKAIGVAIGCILGMFPLLFLSDEEDKKP 207

  Fly   267 VKD 269
            .||
Zfish   208 KKD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17715NP_001036410.1 DUF2453 151..258 CDD:287478 52/106 (49%)
tmem65NP_001122284.1 DUF2453 92..199 CDD:287478 52/106 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577993
Domainoid 1 1.000 109 1.000 Domainoid score I6315
eggNOG 1 0.900 - - E1_KOG4619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D573372at33208
OrthoFinder 1 1.000 - - FOG0006142
OrthoInspector 1 1.000 - - oto41033
orthoMCL 1 0.900 - - OOG6_104678
Panther 1 1.100 - - LDO PTHR21706
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4172
SonicParanoid 1 1.000 - - X4432
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.