DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slmap and slmapb

DIOPT Version :9

Sequence 1:NP_001036397.2 Gene:Slmap / 3355127 FlyBaseID:FBgn0040011 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_005162107.1 Gene:slmapb / 393146 ZFINID:ZDB-GENE-040426-809 Length:377 Species:Danio rerio


Alignment Length:412 Identity:86/412 - (20%)
Similarity:175/412 - (42%) Gaps:85/412 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 EQMMLTVPNRISF--DE--------------VQRLSSFLQEAAQREKSLKAKLSSLQGVLDNTRK 390
            ||.:....|::|.  ||              :|||:..||||.::..|.|.|...|||:|:..::
Zfish     3 EQKLKDPINKVSLIKDELSRSTVEASESEKVIQRLNQELQEANEQPNSSKYKCVELQGLLEEEKR 67

  Fly   391 NSAMCWQSMITEDQLLHKINILEKKLQMMEKNIPENALRNEIVKLLEDKTTYQLTAKEALRKVYQ 455
            .:..      ..::...::.:|:.:||.:::.: || ||::     :|...:      ::|:...
Zfish    68 ANKQ------QAEESAKQMKVLQTQLQKLQEEM-EN-LRDQ-----KDSAVF------SMRQETH 113

  Fly   456 ERCDAMQMLSK-MEMAYATSENECGILRAQVLTLKQTLTDFNTRLEELQQEYMEFKK--ESVRQE 517
            ...:.:|:|.: ||...|..|:|...|:..:.||       .:.||:.||...::::  |||:..
Zfish   114 AAQEEVQVLRRTMEKTAAEREHEVSALKGNLATL-------TSELEKWQQAANKYERELESVQAS 171

  Fly   518 Q-EAKEQESRSLEVLNGKLTTQELELKELRLQVSRIHRDLSESDTEHLKERIVLKNLDTINLDDY 581
            . :..:|..|:.:...|:|...:.:.:.||...:.:..:..:...:..||:..|:|.::....:.
Zfish   172 HLQQNQQRDRATKQQAGELEKVQKDCESLRRDCASLRSEREQLADKQQKEKASLQNENSSLRSEK 236

  Fly   582 DHAQDRALNERDDNESSDDDILSVSPAKNVLSETKKRKLKLSNPDLEEGNYKSNVLRLLKNSDLG 646
            :..|.:......:.:||.....|       ||.|.| .|:.:..|||:   :.:||:.....|.|
Zfish   237 EQLQKKQQQLEKELDSSKKQNTS-------LSNTVK-SLEKTQADLEK---RLSVLQEEHQRDNG 290

  Fly   647 KGEEGSSVLKAIFNGDDEAFECKVKEEEDMANDSVPTEFVSRNTSEIVDHFKNHSSTTHTILEDS 711
            :.|:.:|.:|.:           .||.|:|          ....|.:...|:|..       |:.
Zfish   291 QLEQSNSRIKEL-----------QKEYEEM----------QAELSGLRGKFENAE-------EEK 327

  Fly   712 AATKLSAPNAESKEKLVDVEEN 733
            .:..|....::.:.:|:..::|
Zfish   328 RSVSLELQQSQERLRLMQDKDN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlmapNP_001036397.2 FHA 216..311 CDD:238017
FHA <225..326 CDD:224630
slmapbXP_005162107.1 SMC_prok_B 66..>352 CDD:274008 66/349 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15715
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.