DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slmap and Rnf8

DIOPT Version :9

Sequence 1:NP_001036397.2 Gene:Slmap / 3355127 FlyBaseID:FBgn0040011 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_006256287.1 Gene:Rnf8 / 361815 RGDID:1308035 Length:503 Species:Rattus norvegicus


Alignment Length:398 Identity:98/398 - (24%)
Similarity:158/398 - (39%) Gaps:108/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LQPNQDCKVGR-------LIAKSKAGEGNAIFDCK-VLSRNHAILWYTPDGKFWVKDTKSSNGTF 285
            |:...:..:||       ||:|.          |. ::||||.:|...|:|::.:.|.||.||.:
  Rat    32 LEAGSEVTIGRGFSVTYQLISKV----------CPLMISRNHCVLKQNPEGQWTIMDNKSLNGVW 86

  Fly   286 INDNKLGSDPAE---LHYGDIVKFGV------------EVIENSRQEVHGCI------------- 322
            :|..:|.  |.:   :..||.::.||            ||||..|:.:..|:             
  Rat    87 LNRERLA--PLQGYCIRKGDHIQLGVPLESKEHAEYEYEVIEEDRESLAPCLAPKNDHTTEKHKG 149

  Fly   323 LARVALFLPNGQEAISVE----------------AEQMMLTVPNRISFDEVQRLSSFLQ--EAAQ 369
            |.....|..:|.|::..|                ||...|......:...:..|...|.  ||::
  Rat   150 LRTKRKFSSDGVESLPAEGPSDLRCPLAKGSSKPAEPEKLHGKGEAASQPLGCLCPTLASLEASE 214

  Fly   370 REKSLKAKLSSLQGVLDNTRKNSAMCWQSMITEDQLLHKI---NILEKKLQMMEK-----NIPEN 426
            |.....| .|:|..||:...|....|..|.......|.|:   .:|:.|.||.||     |:...
  Rat   215 RTAGPHA-CSTLPKVLELYPKKQKACSPSASQSSLELFKMTMSRMLKLKTQMQEKQIAVLNVKRQ 278

  Fly   427 ALR---NEIVKL---LEDKTTYQLTAKEA--------LRKVYQERCDAMQMLSKMEMAYATSENE 477
            |.:   .::|::   |.|..: ||.|::|        |.|.:||....:|.|.|       .:.|
  Rat   279 ARKGSSKKVVRMEKELRDLQS-QLYAEQAQQQARVEQLEKTFQEEEQHLQGLEK-------EQGE 335

  Fly   478 CGILRAQVLTLKQTLTDFNTRLEELQQEYMEFK-------KESVRQEQEAKEQESRSLEVLNGKL 535
            |. |:.|:|   |.|.:....:|||.:...:|:       ||..|.::|..:.:::..|||:...
  Rat   336 CD-LKQQLL---QALQEHRALMEELDRSKKDFEKIIQAKNKELERTKEEKDKVQAQKEEVLSHMN 396

  Fly   536 TTQELELK 543
            ...|.||:
  Rat   397 DVLENELQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlmapNP_001036397.2 FHA 216..311 CDD:238017 27/104 (26%)
FHA <225..326 CDD:224630 33/132 (25%)
Rnf8XP_006256287.1 FHA 17..110 CDD:238017 24/89 (27%)
FHA <38..109 CDD:224630 23/82 (28%)
Tho2 267..>325 CDD:288156 15/58 (26%)
RING 404..446 CDD:238093 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.