DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slmap and dma1

DIOPT Version :9

Sequence 1:NP_001036397.2 Gene:Slmap / 3355127 FlyBaseID:FBgn0040011 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_593733.1 Gene:dma1 / 2542409 PomBaseID:SPAC17G8.10c Length:267 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:36/123 - (29%)
Similarity:61/123 - (49%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PKSHKFETRSIL-----LQPNQDCKVGRLIAKSKAGEGNAI-FDCKVLSRNHAILWYTPDGKFWV 275
            |.:|.|....::     .|.|....:||...:...|:.:|| |..||:||.||.::| .:..:::
pombe    37 PNAHSFSFDPLVRYWNRKQNNLPIYIGRYTERYNGGDVSAIVFRSKVVSRRHAQIFY-ENNTWYI 100

  Fly   276 KDTKSSNGTFINDNKLG-----SDPAELHYGDIVKFGVEVIENSRQEVHGCILARVAL 328
            :|..||:|||:|..:|.     |.|..:...||::.|.: .....:..:.|:.|||.|
pombe   101 QDMGSSSGTFLNHVRLSPPSKTSKPYPISNNDILQLGAD-YRGGHEVNYRCVRARVEL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlmapNP_001036397.2 FHA 216..311 CDD:238017 31/104 (30%)
FHA <225..326 CDD:224630 30/111 (27%)
dma1NP_593733.1 FHA 1..172 CDD:224630 36/123 (29%)
FHA 55..139 CDD:238017 28/84 (33%)
zf-RING_11 191..219 CDD:293728
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R322
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.