DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slmap and Traf3ip3

DIOPT Version :9

Sequence 1:NP_001036397.2 Gene:Slmap / 3355127 FlyBaseID:FBgn0040011 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_694777.3 Gene:Traf3ip3 / 215243 MGIID:2441706 Length:513 Species:Mus musculus


Alignment Length:377 Identity:95/377 - (25%)
Similarity:168/377 - (44%) Gaps:79/377 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 EAEQMMLTVPNRISFD----------EVQRLSSFLQEAAQREKSLKAKLSSLQGVLDNTRKNSAM 394
            :||:.:.|:.|..|..          ::.:||.:|:||..||..||.|:..||.:|....:.|..
Mouse   168 KAEEALPTIKNDASQQTKCGVAVLDKDIIQLSEYLKEALHRELILKKKMVILQDLLPALIRASDS 232

  Fly   395 CWQSMITEDQLLHKINILEKKL-QMMEKNIPENALRNEIVKLLEDKTTYQLTAKEALRKVYQERC 458
            .|:..:.||:|..|:..||.:| ..::|:.|. .::..::::.:.:::|:..||.:|:||.:|:.
Mouse   233 SWKGQLNEDKLKGKLRSLENQLYTCLQKHSPW-GMKKVLLEMEDQRSSYEQKAKASLQKVLEEKM 296

  Fly   459 DAMQMLSKMEMAYATSENECGILRAQVLTLKQ---TLTDFNTRLEELQQEYMEFKKESV--RQEQ 518
            .|.|.|.:.:::.|.:|.:|...::|...||:   ||.|.:..||. |...::.|.:..  |..|
Mouse   297 CAEQQLQRAQLSLALAEQKCQEWKSQYEALKEDWRTLGDQHRELES-QLHVLQSKLQGADSRDSQ 360

  Fly   519 --------EAKEQESRS-LEVLNGKLTTQELELKELRLQVSRIHRDLSESDTEHLKERI-----V 569
                    |.:.||.:: ||.|.|....|..|.::|:.|:.:     ||.:.:.|..::     :
Mouse   361 MSQALQLLENEHQELQTKLESLQGDGEQQSSETQDLQDQLKK-----SEEEKQALVSKVQQLQSL 420

  Fly   570 LKNLDTINLDDYDHAQDRALNERDDNESSDDDILSVSPAKNVLSETKKRKLKLSNPDLEEGNYKS 634
            |:| .::.|.:    |::.|.:        |..|.|...|..|.|.|           .||..|.
Mouse   421 LQN-QSLQLQE----QEKLLKK--------DQGLPVWNPKLSLDEVK-----------PEGTRKE 461

  Fly   635 NVLRLLKNSDLGKGEEGSSVLKAIFNGDDEAFECKVKEEEDMANDSVPTEFV 686
                        |.||....|:      .|.|:.:|||:|......:|...|
Mouse   462 ------------KEEELRDQLQ------KETFQLQVKEKELQCGQWLPVLMV 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlmapNP_001036397.2 FHA 216..311 CDD:238017
FHA <225..326 CDD:224630
Traf3ip3NP_694777.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..171 1/2 (50%)
COG4372 216..>437 CDD:226809 58/232 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..402 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15715
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.