DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slmap and LOC100330186

DIOPT Version :9

Sequence 1:NP_001036397.2 Gene:Slmap / 3355127 FlyBaseID:FBgn0040011 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_005164664.1 Gene:LOC100330186 / 100330186 -ID:- Length:460 Species:Danio rerio


Alignment Length:472 Identity:97/472 - (20%)
Similarity:181/472 - (38%) Gaps:91/472 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 FWVKDTKSSNGTFINDNKLGSDPAELHYGDIVKFGVEVIENSRQEVHGCILARVALFLPNGQEAI 337
            |.::.|....|:..::.:  .|..:|..|:..|...:..|..::|                ||.:
Zfish    31 FGIQMTAKERGSLEHNEE--RDQEDLDTGNGEKGQEDEQEKKKEE----------------QEEL 77

  Fly   338 SVEAEQMMLTVPNRISFDEVQRLSSFLQEAAQREKSLKAK--LSSLQGVLDNTRKNSAMCWQSMI 400
            ...|::......|.:.....|.:...|:....||.|.|.:  .:.|||:|:..|..||       
Zfish    78 RGAADEEEEEEENELEVLRSQVVQLLLELEETREVSQKHEDSYNELQGLLEEERLASA------- 135

  Fly   401 TEDQLLHKINILEKKLQMMEKNIPENALRNEIVKLLEDKTTYQLTAKEALRKVYQERCDAMQMLS 465
                  |:.....:::|.::..:  .:::.|:..|.|:|.:....|:|.||....|   ..::..
Zfish   136 ------HQAESFTRQIQRLQAQL--RSVQEELDSLEEEKASELWEAQEELRAAQDE---VQELQQ 189

  Fly   466 KMEMAYATSENECGILRAQVLTLKQTLTDFNTRLEELQQEYMEFKKESVRQEQEAKEQESRSLEV 530
            ..|.|.|..||:..:|:.::..::..|    .||....||| |.:..::|.|...|.|.....|.
Zfish   190 AAEEAAAERENDIALLQEELCRMRAEL----ERLRGTTQEY-ELELTTLRAEINMKNQSREQQEK 249

  Fly   531 LNGKLTTQELE----LKELRLQVSRIHRDLSESDTEHLKERI-VLKNLDTINLDDYDHAQDRALN 590
            ..|....|.:|    ||:        .|...::|.:.|.|:: :|:.....:.|.|     .||.
Zfish   250 PGGGDVDQLMEECRSLKD--------ERQTLKNDNKELSEKLEILEQQRASSTDSY-----LALK 301

  Fly   591 ERDDNESSDDDI------------LSVSPAKNVLSETKKR---KLKLSNPDLEEGNYKSNVLRLL 640
            .:.::...||::            |.:...|.|.:.|:|.   :.|...|..:.|.: |.|..| 
Zfish   302 TQQNDTEKDDEVETEVKAEGFISTLEMEGGKCVDAYTQKNISFEGKPITPTGKSGGF-SEVFSL- 364

  Fly   641 KNSDLGKGEEGSSVLKAIFNGDDEAFECKVKEEEDMANDSVPTEFVSRNTSEIVDHFKNHSSTTH 705
             ...|.:.||.:|.::.         ||:..:.|.|....: .|...|..:|:....:.:.:...
Zfish   365 -RDQLKQAEEKASKVQR---------ECEGLKGELMELQGL-YESSQRERAELEAELQRYRAELD 418

  Fly   706 TILEDSAATKLSAPNAE 722
            .:....|.:  |.|::|
Zfish   419 RLAGRKAQS--STPSSE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlmapNP_001036397.2 FHA 216..311 CDD:238017 7/37 (19%)
FHA <225..326 CDD:224630 9/52 (17%)
LOC100330186XP_005164664.1 LCD1 212..>295 CDD:286837 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.