DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and Cetn1

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_445913.1 Gene:Cetn1 / 84592 RGDID:620246 Length:172 Species:Rattus norvegicus


Alignment Length:157 Identity:118/157 - (75%)
Similarity:145/157 - (92%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDC 90
            :||.|||.||:|.||.:::|||||||::|:|.|:|||||||:|||||||:|||:|:|||::||:.
  Rat    16 KKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEA 80

  Fly    91 SGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREM 155
            :|:|:||.||.:||.|||||||||||||||||||||:||||||:||||||.||||:||||||:||
  Rat    81 TGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEM 145

  Fly   156 IDEADLDNDGEVNQEEFLRIMKKTSLY 182
            |||||.|.|||||:||||:|||||:||
  Rat   146 IDEADRDGDGEVNEEEFLKIMKKTNLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 116/155 (75%)
EFh 42..104 CDD:238008 39/61 (64%)
EFh 115..177 CDD:238008 52/61 (85%)
Cetn1NP_445913.1 PTZ00183 15..172 CDD:185503 116/155 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341735
Domainoid 1 1.000 114 1.000 Domainoid score I5918
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3219
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm44895
orthoMCL 1 0.900 - - OOG6_101416
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.