DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and AT1G18210

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_173259.1 Gene:AT1G18210 / 838401 AraportID:AT1G18210 Length:170 Species:Arabidopsis thaliana


Alignment Length:172 Identity:56/172 - (32%)
Similarity:80/172 - (46%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NANPATVPAKRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEP 74
            :|||.|......|            :..|...::|:.||.||:.|.|.|.|.||....:|:|...
plant     3 SANPETAKPTPAT------------VDMANPEELKKVFDQFDSNGDGKISVLELGGVFKAMGTSY 55

  Fly    75 KKEEIKRMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRV 139
            .:.|:.|::.::|.|..|.|..:.|..|    .....:..||..||.|:|.|..|.||...|.:|
plant    56 TETELNRVLEEVDTDRDGYINLDEFSTL----CRSSSSAAEIRDAFDLYDQDKNGLISASELHQV 116

  Fly   140 ARELGETLTDEELREMIDEADLDNDGEVNQEEFLRIMKKTSL 181
            ...||.:.:.|:...||...|.|.||.||.|||.::|..:||
plant   117 LNRLGMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSSSL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 51/156 (33%)
EFh 42..104 CDD:238008 21/61 (34%)
EFh 115..177 CDD:238008 26/61 (43%)
AT1G18210NP_173259.1 PTZ00184 22..154 CDD:185504 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.