DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and AT4G27280

DIOPT Version :9

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_194458.1 Gene:AT4G27280 / 828836 AraportID:AT4G27280 Length:130 Species:Arabidopsis thaliana


Alignment Length:88 Identity:34/88 - (38%)
Similarity:48/88 - (54%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARE---LGETLTDEELREMID 157
            |:.||..|...:..:....|:...|.|..|.:.|.|:|.:|:|.|..   ||: ||||::|.||.
plant    19 FHDFLPTMAGNLGGEGLIGELCNGFELLMDREKGVITFESLRRNAAAVLGLGD-LTDEDVRCMIK 82

  Fly   158 EADLDNDGEVNQEEFLRIMKKTS 180
            |.|.|.||.:||.||..:|.:.|
plant    83 EGDFDCDGALNQMEFCVLMFRLS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 34/88 (39%)
EFh 42..104 CDD:238008 3/7 (43%)
EFh 115..177 CDD:238008 28/64 (44%)
AT4G27280NP_194458.1 EF-hand_8 50..104 CDD:404678 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.