DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CAM8

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_193200.1 Gene:CAM8 / 827114 AraportID:AT4G14640 Length:151 Species:Arabidopsis thaliana


Alignment Length:142 Identity:68/142 - (47%)
Similarity:94/142 - (66%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVF 99
            |::.|..:.||||.|||.:|.|.|.|:||...||:|...|.::|:..:|::||.|.:|.|.|..|
plant     6 LTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEF 70

  Fly   100 LQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDND 164
            |.||..|:.|.|.:||:.:||::||.|..|.||...|..|...|||.|||||:.:||.|||||.|
plant    71 LNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEADLDGD 135

  Fly   165 GEVNQEEFLRIM 176
            |:||.:||:::|
plant   136 GQVNYDEFVKMM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 68/142 (48%)
CAM8NP_193200.1 PTZ00184 6..148 CDD:185504 68/142 (48%)

Return to query results.
Submit another query.