DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and CML11

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_188933.1 Gene:CML11 / 821865 AraportID:AT3G22930 Length:173 Species:Arabidopsis thaliana


Alignment Length:60 Identity:13/60 - (21%)
Similarity:37/60 - (61%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLLQSPEPEKL-LKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQ 93
            |||.:.|.:|| |::..::.:...:..:.|.::...::|:.:::|:.|..:|:..:|:::
plant   262 HLLVTLEKQKLELERQRLSIEAERLQVEKERLQIERERLRHLDMEHERLQLEKERLQIER 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 13/60 (22%)
CML11NP_188933.1 PTZ00184 27..170 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.