DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17493 and AT3G03410

DIOPT Version :10

Sequence 1:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_186991.1 Gene:AT3G03410 / 821262 AraportID:AT3G03410 Length:131 Species:Arabidopsis thaliana


Alignment Length:135 Identity:40/135 - (29%)
Similarity:61/135 - (45%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KEAFDLFDNEGTGYIEVKELKVAIRALGFEP--KKEEIKRMISDIDKDCSGRIAFNVFLQLMTIK 106
            |..|:.||....|.:.:.|.:..  ||.|.|  .:|:|.:...:||.|.:|.:..:.|...:   
plant     4 KRVFEKFDKNKDGKLSLDEFREV--ALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCI--- 63

  Fly   107 MAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDNDGEVNQEE 171
              ||..||    .|...|.|..|||...........||:..|:|...|.:..||:|.||.:|.:|
plant    64 --EKMLKE----VFVFCDVDGDGKIPASESYVTMTSLGKKFTEETSAEKVRAADVDGDGYLNFDE 122

  Fly   172 FLRIM 176
            |:.::
plant   123 FMALV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 40/135 (30%)
AT3G03410NP_186991.1 FRQ1 5..127 CDD:444056 39/132 (30%)

Return to query results.
Submit another query.